NSE2_RAT Q4V8A0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q4V8A0
Recommended name：E3 SUMO-protein ligase NSE2
EC number：EC:2.3.2.-
Alternative names：E3 SUMO-protein transferase NSE2 Curated MMS21 homolog Non-structural maintenance of chromosomes element 2 homolog (Non-SMC element 2 homolog)
Cleaved into：
GeneID：299957
Gene names (primary )：Nsmce2
Gene names (synonym )：Mms21
Gene names (ORF )：
Length：247
Mass：28,246
Sequence：MPGRSSTNSGSTRYISFSGVESALSSLKTFQSCISSGMDTVSSVALDLVETQTEVSSEYSMDKAMVEFAKMDRELNHYVKAVQSTINHVKEERPEKVPDLKLLVEKKFLALQDKNSDADFKENEKFVQFKQQLRELKKQYGIHADRENDGIEGMDEDMIVTQSQTNFICPITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCPKIGCSHTDMRMSDLIPDEALRRAIESHNKKKKRHSE
Tissue specificity：
Induction：
Developmental stage：
Protein families：