BEX1_RAT   Q3MKQ2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3MKQ2

Recommended name:Protein BEX1

EC number:

Alternative names:

Cleaved into:

GeneID:501625

Gene names  (primary ):Bex1

Gene names  (synonym ):

Gene names  (ORF ):

Length:128

Mass:15,248

Sequence:MESKDQGAKNLNMENDHQKKEEKEEKPQDTIKREPVVAPTFEAGKNCAPRGGRRRFRVRQPIAHYRWDLMHRVGEPQGRMREENVQRFGEDMRQLMEKLRERQLSHSLRAVSTDPPHHDHHDEFCLMP

Tissue specificity:Expressed in the central nervous system. Expressed in Schwann cells from newborn sciatic nerve. 1

Induction:

Developmental stage:Oscillates during the cell cycle, being lowest at G1 and highest at S phase (at protein level). 1

Protein families:BEX family


   💬 WhatsApp