ATNG_RAT Q04679
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q04679
Recommended name：Sodium/potassium-transporting ATPase subunit gamma
EC number：
Alternative names：FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain
Cleaved into：
GeneID：
Gene names (primary )：Fxyd2
Gene names (synonym )：Atp1c, Atp1g1
Gene names (ORF )：
Length：66
Mass：7,257
Sequence：MTELSANHGGSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLILLSKRFRCGGSKKHRQVNEDEL
Tissue specificity：Highest levels expressed in the kidney and spleen. Restricted to the basolateral membrane in renal epithelial cells and varies in its level of expression along the nephron.
Induction：
Developmental stage：
Protein families：