BKRB1_RAT P97583
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97583
Recommended name：B1 bradykinin receptor
EC number：
Alternative names：Kinin B1 receptor (KB1)
Cleaved into：
GeneID：81509
Gene names (primary )：Bdkrb1
Gene names (synonym )：B1bkr, Bkr
Gene names (ORF )：
Length：337
Mass：38,378
Sequence：MASEVLLELQPSNRSLQAPANITSCESALEDWDLLYRVLPGFVITICFFGLLGNLLVLSFFLLPWRQWWWQQRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIGNRFNWPFGTDLCRVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSIPTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILASLRGQKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEITDLGLQLANFFAFVNSCLNPLIYVFAGRLLKTRVLGTL
Tissue specificity：Expressed in bladder, lung, duodenum, kidney, uterus, thymus, salivary gland, testis, prostate, macrophages, aorta, spleen and heart.
Induction：
Developmental stage：By lipopolysaccharide (LPS), four hours after treatment levels show an increase in many tissues. After 12 hours maximum levels are observed in the heart. 2 s
Protein families：