FKB1B_RAT P97534
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97534
Recommended name：Peptidyl-prolyl cis-trans isomerase FKBP1B
EC number：EC:5.2.1.8
Alternative names：PPIase FKBP1B
Cleaved into：
GeneID：58950
Gene names (primary )：Fkbp1b
Gene names (synonym )：
Gene names (ORF )：
Length：108
Mass：11,795
Sequence：MGVEIETISPGDGRTFPKKGQICVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Tissue specificity：Detected in heart muscle (at protein level). Ubiquitous. 1
Induction：
Developmental stage：
Protein families：