HPCA_RAT   P84076


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P84076

Recommended name:Neuron-specific calcium-binding protein hippocalcin Curated

EC number:

Alternative names:

Cleaved into:

GeneID:29177

Gene names  (primary ):Hpca

Gene names  (synonym ):

Gene names  (ORF ):

Length:193

Mass:22,427

Sequence:MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Tissue specificity:Neuron-specific in the hippocampus (PubMed:1280427). Also detected in olfactory epithelium (PubMed:15336960). 2 s

Induction:

Developmental stage:

Protein families:recoverin family


   💬 WhatsApp