PHF5A_RAT   P83871


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P83871

Recommended name:PHD finger-like domain-containing protein 5A

EC number:

Alternative names:Splicing factor 3B-associated 14 kDa protein (SF3b14b)

Cleaved into:

GeneID:192246

Gene names  (primary ):Phf5a

Gene names  (synonym ):Ini

Gene names  (ORF ):

Length:110

Mass:12,405

Sequence:MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Tissue specificity:Expressed in all tissues tested including brain, heart, ovary, uterus, skeletal muscle and testis. 1

Induction:

Developmental stage:By estrogen. 1

Protein families:


   💬 WhatsApp