DOPD_RAT   P80254


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P80254

Recommended name:D-dopachrome decarboxylase

EC number:EC:4.1.1.84

Alternative names:D-dopachrome tautomerase

Cleaved into:

GeneID:29318

Gene names  (primary ):Ddt

Gene names  (synonym ):

Gene names  (ORF ):

Length:118

Mass:13,133

Sequence:MPFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL

Tissue specificity:In all organs tested, highest levels in liver. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp