NEK6_RAT P59895
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P59895
Recommended name：Serine/threonine-protein kinase Nek6 1 Publication
EC number：EC:2.7.11.34
Alternative names：Never in mitosis A-related kinase 6 (NimA-related protein kinase 6)
Cleaved into：
GeneID：360161
Gene names (primary )：Nek6
Gene names (synonym )：
Gene names (ORF )：
Length：313
Mass：35,835
Sequence：MAGQPSHMPHGGSPNHLCHVLGPAHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNHRPDIEYVHQVAKQMHVWTSST
Tissue specificity：
Induction：
Developmental stage：
Protein families：protein kinase superfamily