AQP7_RAT P56403
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56403
Recommended name：Aquaporin-7 1 Publication
EC number：
Alternative names：Aquaglyceroporin-7
Cleaved into：
GeneID：29171
Gene names (primary )：Aqp7
Gene names (synonym )：
Gene names (ORF )：
Length：269
Mass：28,882
Sequence：MAGSVLENIQSVLQKTWVREFLAEFLSTYVLMVFGLGSVAHMVLGERLGSYLGVNLGFGFGVTMGIHVAGGISGAHMNAAVTFTNCALGRMAWKKFPIYVLGQFLGSFLAAATTYLIFYGAINHYAGGELLVTGPKSTANIFATYLPEHMTLWRGFVDEVFVTGMLQLCIFAITDKLNSPALQGTEPLMIGILVCVLGVSLGMNTGYAINPSRDLPPRFFTFIAGWGKKVFSAGNNWWWVPVVAPLLGAYLGGIVYLGLIHAGIPPQGS
Tissue specificity：Detected in heart, kidney and testis. 1
Induction：
Developmental stage：Expressed at late stages of spermatogenesis, from late to maturing spermatids (at protein level). 1
Protein families：MIP/aquaporin (TC 1.A.8) family