MAF_RAT P54844
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P54844
Recommended name：Transcription factor Maf
EC number：
Alternative names：
Cleaved into：
GeneID：54267
Gene names (primary )：Maf
Gene names (synonym )：Maf2
Gene names (ORF )：
Length：369
Mass：38,457
Sequence：MASELAMNNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPSPSFSAPSPASGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISNSHQLQGGFDGYARGAQQLAAAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGGAPHYHHHHHHATGHHHHPTAGAPGAAGSASASASGAGGAGGGGPASAGGGGGGGGGGTAGAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENCSSSDNPSSPEFFM
Tissue specificity：Expressed in the muscle, uterus, intestine, kidney, liver and skin. Expressed in the lens epithelial and fiber cells. 2 s
Induction：
Developmental stage：Expressed in lens cells at 12 dpc. Expressed in the cartilage of ribs and limbs, in the eyes and spinal cord at 15 dpc. Expressed in the outer equatorial epithelium and lens fibers at 16 dpc (at protein level). Expressed throughout the lens fiber cells at 13 and 16 dpc; not detected in the epithelium of the lens. In the eyes, confined to the lens; not detected in the retina at 15 dpc. In spinal cord, expressed in the dorsal and ventral part of the dorsal horn at 15 dpc. Predominantly expressed in post-mitotic cells. 1
Protein families：