RIDA_RAT P52759
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52759
Recommended name：2-iminobutanoate/2-iminopropanoate deaminase By Similarity
EC number：EC:3.5.99.10
Alternative names：Liver perchloric acid-soluble protein 2 Publications (L-PSP 1 Publication) Reactive intermediate imine deaminase A homolog Imported Translation inhibitor L-PSP ribonuclease 1 Publication UK114 antigen homolog 1 Publication rp14.5 1 Publication
Cleaved into：
GeneID：65151
Gene names (primary )：Rida
Gene names (synonym )：Psp1 Imported
Gene names (ORF )：
Length：137
Mass：14,303
Sequence：MSSIIRKVISTSKAPAAIGAYSQAVLVDRTIYVSGQIGMDPSSGQLVPGGVAEEAKQALKNLGEILKAAGCDFTNVVKTTVLLADINDFGTVNEIYKTYFQGNLPARAAYQVAALPKGSRIEIEAIAVQGPFTTAGL
Tissue specificity：Liver and kidney. 1
Induction：
Developmental stage：
Protein families：