ERP29_RAT   P52555


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P52555

Recommended name:Endoplasmic reticulum resident protein 29

EC number:

Alternative names:Endoplasmic reticulum resident protein 31 (ERp31)

Cleaved into:

GeneID:117030

Gene names  (primary ):Erp29

Gene names  (synonym ):

Gene names  (ORF ):

Length:260

Mass:28,575

Sequence:MAAAVPGAVSLSPLLSVLLGLLLLSAPHGASGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYSGAVKVGAIQRWLKGQGVYLGMPGCLPAYDALAGQFIEASSREARQAILKQGQDGLSGVKETDKKWASQYLKIMGKILDQGEDFPASELARISKLIENKMSEGKKEELQRSLNILTAFRKKGAEKEEL

Tissue specificity:Ubiquitous. Mostly expressed in secretory tissues.

Induction:

Developmental stage:By stress.

Protein families:


   💬 WhatsApp