DLX5_RAT P50575
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50575
Recommended name：Homeobox protein DLX-5
EC number：
Alternative names：
Cleaved into：
GeneID：25431
Gene names (primary )：Dlx5
Gene names (synonym )：
Gene names (ORF )：
Length：289
Mass：31,426
Sequence：MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYGKALNPYQYQYHSVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY
Tissue specificity：Mainly expressed in several neuronal tissues and developing tissues.
Induction：
Developmental stage：Present at high levels in embryos on embryonic day 14 (14 dpc), in skeletal tissues on 18 dpc, and in adult brain. At lower levels in newborn rib cartilage, embryo soft tissues on 18 dpc, newborn skin and adult heart.
Protein families：