SYT4_RAT P50232
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50232
Recommended name：Synaptotagmin-4
EC number：
Alternative names：
Cleaved into：
GeneID：64440
Gene names (primary )：Syt4
Gene names (synonym )：
Gene names (ORF )：
Length：425
Mass：47,685
Sequence：MAPITTSRVEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRRSAKSNKTPPYKFVHVLKGVDIYPENLSSKKKFGGDDKSEAKRKAALPNLSLHLDLEKRDLNGNFPKTNPKAGSSSDLENVTPKLFPETEKEAVSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPVFDETFTFYGVPYPHIQELSLHFTVLSFDRFSRDDVIGEVLVPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCDG
Tissue specificity：Widely expressed (PubMed:7892240). Expressed in the brain (PubMed:7892240). Expressed in pituitary gland, cerebellum, cortex, hypothalamus and hippocampus (PubMed:7892240). 2 s
Induction：
Developmental stage：Up-regulated by potassium depolarization, calcium ionophore, ATP and forskolin in culture cells (PubMed:7892240). Up-regulated by kainate in the hippocampus and piriform cortex (PubMed:7892240). 1
Protein families：synaptotagmin family