RDH16_RAT P50170
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50170
Recommended name：Retinol dehydrogenase 16
EC number：EC:1.1.1.105
Alternative names：29 kDa protein Retinol dehydrogenase 2 Retinol dehydrogenase type 1 1 Publication Retinol dehydrogenase type II 1 Publication (RODH II 1 Publication)
Cleaved into：
GeneID：299511
Gene names (primary )：Rdh16
Gene names (synonym )：Rdh2, Rodh1 1 Publication, Rodhii
Gene names (ORF )：
Length：317
Mass：35,597
Sequence：MWLYLLALVGLWNLLRLFRERKVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEQLRSKTSDRLETVILDVTKTESIVAATQWVKERVGNTGLWGLVNNAGISGHLGPNEWMNKQNIASVLDVNLLGMIEVTLSTVPLVRKARGRVVNVASIAGRLSFCGGGYCISKYGVEAFSDSLRRELSYFGVKVAIVEPGFFRTDVTNGVTLSSNFQMLWDQTSSEVREVYGENYLASYLKMLNGLDQRCNKDLSLVTDCMEHALTSCHPRTRYSAGWDAKFFYLPMSYLPTFLVDALFYWTSPKPEKAL
Tissue specificity：Liver > kidney > brain > lung > testis. 1
Induction：
Developmental stage：
Protein families：short-chain dehydrogenases/reductases (SDR) family