IOD3_RAT P49897
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49897
Recommended name：Thyroxine 5-deiodinase
EC number：EC:1.21.99.3
Alternative names：5DIII DIOIII Type 3 DI Type III iodothyronine deiodinase
Cleaved into：
GeneID：29475
Gene names (primary )：Dio3
Gene names (synonym )：Itdi3, Txdi3
Gene names (ORF )：
Length：304
Mass：34,096
Sequence：MPRQAASRLVVGEGEGPPGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL
Tissue specificity：Neonatal skin, placenta, skeletal muscle and cerebral cortex. 1
Induction：
Developmental stage：
Protein families：