CX3C1_RAT P35411
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35411
Recommended name:CX3C chemokine receptor 1 By Similarity
EC number:
Alternative names:Fractalkine receptor By Similarity
Cleaved into:
GeneID:171056
Gene names (primary ):Cx3cr1 By Similarity
Gene names (synonym ):Rbs11 1 Publication
Gene names (ORF ):
Length:354
Mass:40,327
Sequence:MPTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSIFYSLVFTFGLVGNLLVVLALTNSRKSKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHNAMCKLTTAFFFIGFFGGIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVASPQFMFTKRKDNECLGDYPEVLQEIWPVLRNSEVNILGFVLPLLIMSFCYFRIVRTLFSCKNRKKARAIRLILLVVVVFFLFWTPYNIVIFLETLKFYNFFPSCGMKRDLRWALSVTETVAFSHCCLNPFIYAFAGEKFRRYLRHLYNKCLAVLCGRPVHAGFSTESQRSRQDSILSSLTHYTSEGEGSLLL
Tissue specificity:Most abundant in adult spinal cord, brain, kidney, gut, uterus and testes. 1
Induction:
Developmental stage:
Protein families: