FOXA3_RAT   P32183


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P32183

Recommended name:Hepatocyte nuclear factor 3-gamma

EC number:

Alternative names:Forkhead box protein A3

Cleaved into:

GeneID:25100

Gene names  (primary ):Foxa3

Gene names  (synonym ):Hnf3g, Tcf-3g, Tcf3g

Gene names  (ORF ):

Length:354

Mass:37,652

Sequence:MLGSVKMEAHDLAEWSYYPEAGEVYSPVNPVPTMAPLNSYMSLNPLSSPYPPGGLQASPLPTGPLAPPAPTAPLGPTFPGLGAGSGTGGSASGYGAPGPGLVHGKEMAKGYRRPLTHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKAKKGNSATSATRNGTVGSATSATTTAATAVTSPAQPQPTPPSEPEAQSGEDVGGLDCASPPSSAPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLLNAS

Tissue specificity:Liver.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp