FOXA3_RAT P32183
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P32183
Recommended name:Hepatocyte nuclear factor 3-gamma
EC number:
Alternative names:Forkhead box protein A3
Cleaved into:
GeneID:25100
Gene names (primary ):Foxa3
Gene names (synonym ):Hnf3g, Tcf-3g, Tcf3g
Gene names (ORF ):
Length:354
Mass:37,652
Sequence:MLGSVKMEAHDLAEWSYYPEAGEVYSPVNPVPTMAPLNSYMSLNPLSSPYPPGGLQASPLPTGPLAPPAPTAPLGPTFPGLGAGSGTGGSASGYGAPGPGLVHGKEMAKGYRRPLTHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKAKKGNSATSATRNGTVGSATSATTTAATAVTSPAQPQPTPPSEPEAQSGEDVGGLDCASPPSSAPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLLNAS
Tissue specificity:Liver.
Induction:
Developmental stage:
Protein families: