CAH2_RAT P27139
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P27139
Recommended name：Carbonic anhydrase 2
EC number：EC:4.2.1.1
Alternative names：Carbonate dehydratase II Carbonic anhydrase II (CA-II) Cyanamide hydratase CA2 (EC:4.2.1.69 By Similarity) . EC:4.2.1.69 (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into：
GeneID：54231
Gene names (primary )：Ca2
Gene names (synonym )：
Gene names (ORF )：
Length：260
Mass：29,114
Sequence：MSHHWGYSKSNGPENWHKEFPIANGDRQSPVDIDTGTAQHDPSLQPLLICYDKVASKSIVNNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKYGDFGKAVQHPDGLAVLGIFLKIGPASQGLQKITEALHSIKTKGKRAAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEGEAEELMVDNWRPAQPLKNRKIKASFK
Tissue specificity：
Induction：
Developmental stage：
Protein families：