GSTK1_RAT P24473
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P24473
Recommended name：Glutathione S-transferase kappa 1
EC number：EC:2.5.1.18
Alternative names：GST 13-13 GST class-kappa GSTK1-1 (rGSTK1) Glutathione S-transferase subunit 13
Cleaved into：
GeneID：297029
Gene names (primary )：Gstk1
Gene names (synonym )：
Gene names (ORF )：
Length：226
Mass：25,493
Sequence：MGPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTLNARL
Tissue specificity：
Induction：
Developmental stage：
Protein families：