CATE_RAT P16228
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16228
Recommended name：Cathepsin E
EC number：EC:3.4.23.34
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Ctse
Gene names (synonym )：
Gene names (ORF )：
Length：398
Mass：43,021
Sequence：MKPLFVLLLLLLLLDLAQAQGVLHRVPLRRHQSLRKKLRAQGQLSDFWRSHNLDMIEFSESCNVDKGINEPLINYLDMEYFGTVSIGSPSQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSSTYMEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVEGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQGYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPKKIKQLQEAIGATPMDGEYAVDCATLNMMPNVTFLINGVSYTLSPTAYILPDLVDGMQFCGSGFQGLDIQPPAGPLWILGDVFIRKFYSVFDRGNNQVGLAPAVP
Tissue specificity：Expressed abundantly in lymphocytes and macrophages of the thymus and spleen, and in the M cells of the intestine. In the brain, expression is limited to reactive microglial cells, the large pyrimidial neurons in the cerebral cortex, the CA1 and CA3 pyrimidial neurons of the hippocampus, the large neurons of the neostriatum, and the Purkinje neurons of the cerebellum. 5 s
Induction：
Developmental stage：Expression increases in all brain regions examined with age, and increases markedly in reactive microglial cells amd CA1 pyrimidial neurons following ischemic injury. In the thymus expression increased steadily up to 8 weeks of age before decreasing to a much lower level by 52 weeks. Expression levels in the spleen and stomach do not appear to vary with age. 1
Protein families：