PA2GA_RAT P14423
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P14423
Recommended name:Phospholipase A2, membrane associated
EC number:EC:3.1.1.4
Alternative names:GIIC sPLA2 Group IIA phospholipase A2 Phosphatidylcholine 2-acylhydrolase 2A
Cleaved into:
GeneID:29692
Gene names (primary ):Pla2g2a
Gene names (synonym ):
Gene names (ORF ):
Length:146
Mass:16,294
Sequence:MKVLLLLAVVIMAFGSIQVQGSLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC
Tissue specificity:
Induction:
Developmental stage:
Protein families: