PA2GA_RAT   P14423


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P14423

Recommended name:Phospholipase A2, membrane associated

EC number:EC:3.1.1.4

Alternative names:GIIC sPLA2 Group IIA phospholipase A2 Phosphatidylcholine 2-acylhydrolase 2A

Cleaved into:

GeneID:29692

Gene names  (primary ):Pla2g2a

Gene names  (synonym ):

Gene names  (ORF ):

Length:146

Mass:16,294

Sequence:MKVLLLLAVVIMAFGSIQVQGSLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp