CP11A_RAT P14137
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P14137
Recommended name：Cholesterol side-chain cleavage enzyme, mitochondrial 1 Publication
EC number：EC:1.14.15.6
Alternative names：CYPXIA1 Cholesterol desmolase Cytochrome P450 11A1 Cytochrome P450(scc)
Cleaved into：
GeneID：29680
Gene names (primary )：Cyp11a1 1 Publication
Gene names (synonym )：Cyp11a, Cyp11a-1
Gene names (ORF )：
Length：526
Mass：60,586
Sequence：MLAKGLCLRSVLVKSCQPFLSPVWQGPGLATGNGAGISSTNSPRSFNEIPSPGDNGWINLYHFLRENGTHRIHYHHMQNFQKYGPIYREKLGNMESVYILDPKDAATLFSCEGPNPERYLVPPWVAYHQYYQRPIGVLFKSSDAWRKDRIVLNQEVMAPDSIKNFVPLLEGVAQDFIKVLHRRIKQQNSGKFSGDISDDLFRFAFESITSVVFGERLGMLEEIVDPESQRFIDAVYQMFHTSVPMLNMPPDLFRLFRTKTWKDHAAAWDVIFSKADEYTQNFYWDLRQKRDFSKYPGVLYSLLGGNKLPFKNIQANITEMLAGGVDTTSMTLQWNLYEMAHNLKVQEMLRAEVLAARRQAQGDMAKMVQLVPLLKASIKETLRLHPISVTLQRYIVNDLVLRNYKIPAKTLVQVASYAMGRESSFFPNPNKFDPTRWLEKSQNTTHFRYLGFGWGVRQCLGRRIAELEMTIFLINVLENFRIEVQSIRDVGTKFNLILMPEKPIFFNFQPLKQDLGSTMPRKGDTV
Tissue specificity：Expressed in the kidney where it localizes to the distal convoluted tubule and the thick ascending limb of the loop of Henle (at protein level) (PubMed:21075169). In the ovary, highly expressed in interstitial cells (at protein level) (PubMed:3948785). Also expressed in adrenal gland and testis (PubMed:3123325). 3 s
Induction：
Developmental stage：Induced by FSH or pregnant mare's serum gonadotropin in ovaries of estrogen-treated immature rats in vivo.
Protein families：