MLRV_RAT P08733
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P08733
Recommended name：Myosin regulatory light chain 2, ventricular/cardiac muscle isoform Curated
EC number：
Alternative names：Myosin light chain 2, slow skeletal/ventricular muscle isoform By Similarity (MLC-2s/v By Similarity)
Cleaved into：
GeneID：363925
Gene names (primary )：Myl2
Gene names (synonym )：Mlc2 Imported
Gene names (ORF )：
Length：166
Mass：18,880
Sequence：MSPKKAKKRLEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Tissue specificity：Abundantly expressed in both cardiac and slow skeletal muscle (soleus), with no detectable expression in fast skeletal muscle (vastus lateralis) or non-muscle tissue. 1
Induction：
Developmental stage：
Protein families：