GSTM7_RAT   P08009


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P08009

Recommended name:Glutathione S-transferase Mu 7

EC number:EC:2.5.1.18

Alternative names:Chain 4 GST Yb3 GST class-mu 3 Glutathione S-transferase Yb-3 1 Publication

Cleaved into:

GeneID:81869

Gene names  (primary ):Gstm7

Gene names  (synonym ):Gstm3

Gene names  (ORF ):

Length:218

Mass:25,681

Sequence:MPMTLGYWDIRGLAHAIRLLLEYTDSSYEEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNPDFEKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEATCLDAFPNLKDFIARFEGLKKISDYMKSSRFLPRPLFTKMAIWGSK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp