GSTM7_RAT P08009
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P08009
Recommended name:Glutathione S-transferase Mu 7
EC number:EC:2.5.1.18
Alternative names:Chain 4 GST Yb3 GST class-mu 3 Glutathione S-transferase Yb-3 1 Publication
Cleaved into:
GeneID:81869
Gene names (primary ):Gstm7
Gene names (synonym ):Gstm3
Gene names (ORF ):
Length:218
Mass:25,681
Sequence:MPMTLGYWDIRGLAHAIRLLLEYTDSSYEEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNPDFEKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEATCLDAFPNLKDFIARFEGLKKISDYMKSSRFLPRPLFTKMAIWGSK
Tissue specificity:
Induction:
Developmental stage:
Protein families: