CP1A2_RAT P04799
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04799
Recommended name：Cytochrome P450 1A2
EC number：EC:1.14.14.1
Alternative names：CYPIA2 Cholesterol 25-hydroxylase By Similarity Cytochrome P-448 Cytochrome P-450d Cytochrome P450-D Hydroperoxy icosatetraenoate dehydratase (EC:4.2.1.152 By Similarity) . EC:4.2.1.152 (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into：
GeneID：24297
Gene names (primary )：Cyp1a2
Gene names (synonym )：Cyp1a-2
Gene names (ORF )：
Length：513
Mass：58,259
Sequence：MAFSQYISLAPELLLATAIFCLVFWVLRGTRTQVPKGLKSPPGPWGLPFIGHMLTLGKNPHLSLTKLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVKQGDDFKGRPDLYSFTLITNGKSMTFNPDSGPVWAARRRLAQDALKSFSIASDPTSVSSCYLEEHVSKEANHLISKFQKLMAEVGHFEPVNQVVESVANVIGAMCFGKNFPRKSEEMLNLVKSSKDFVENVTSGNAVDFFPVLRYLPNPALKRFKNFNDNFVLFLQKTVQEHYQDFNKNSIQDITGALFKHSENYKDNGGLIPQEKIVNIVNDIFGAGFETVTTAIFWSILLLVTEPKVQRKIHEELDTVIGRDRQPRLSDRPQLPYLEAFILEIYRYTSFVPFTIPHSTTRDTSLNGFHIPKECCIFINQWQVNHDEKQWKDPFVFRPERFLTNDNTAIDKTLSEKVMLFGLGKRRCIGEIPAKWEVFLFLAILLHQLEFTVPPGVKVDLTPSYGLTMKPRTCEHVQAWPRFSK
Tissue specificity：By 3-methylcholanthrene (3MC).
Induction：
Developmental stage：
Protein families：