PTHY_RAT   P04089


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P04089

Recommended name:Parathyroid hormone

EC number:

Alternative names:Parathyrin

Cleaved into:

GeneID:24694

Gene names  (primary ):Pth

Gene names  (synonym ):

Gene names  (ORF ):

Length:115

Mass:12,722

Sequence:MMSASTMAKVMILMLAVCLLTQADGKPVKKRAVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEENVLVDGNSKSLGEGDKADVDVLVKAKSQ

Tissue specificity:Hypothalamus and parathyroid gland.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp