ANF_RAT P01161
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01161
Recommended name：Natriuretic peptides A Curated
EC number：
Alternative names：Long-acting natriuretic peptide By Similarity (LANP By Similarity) Alternative names: Long-acting natriuretic hormone Curated (LANH Curated) , Pro atrial natriuretic factor 1-30 By Similarity (proANF 1-30 By Similarity) , Pro atrial natriuretic peptide 1-30 Curated (proANP 1-30 Curated) Vessel dilator By Similarity (VSDL By Similarity) Alternative names: Pro atrial natriuretic factor 31-67 By Similarity (proANF 31-67 By Similarity) , Pro atrial natriuretic peptide 31-67 Curated (proANP 31-67 Curated) Kaliuretic peptide By Similarity (KP By Similarity) Alternative names: Pro atrial natriuretic factor 79-98 By Similarity (proANF 79-98 By Similarity) , Pro atrial natriuretic peptide 79-98 Curated (proANP 79-98 Curated) Urodilatin By Similarity (URO By Similarity) Alternative names: CDD 95-126 By Similarity, CDD-ANP (95-126) By Similarity, Pro atrial natriuretic peptide 95-126 By Similarity (proANP 95-126 By Similarity) Auriculin-C Curated Alternative names: Atrial natriuretic factor 1-33 1 Publication (ANF 1-33 1 Publication) More chains
Cleaved into：
GeneID：24602
Gene names (primary )：Nppa
Gene names (synonym )：
Gene names (ORF )：
Length：152
Mass：16,556
Sequence：MGSFSITKGFFLFLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKMPVEDEVMPPQALSEQTDEAGAALSSLSEVPPWTGEVNPSQRDGGALGRGPWDPSDRSALLKSKLRALLAGPRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR
Tissue specificity：High levels of expression in the atria compared to the ventricles (PubMed:1837590). Very low levels of expression detected in extracardiac tissues such as the brain, hypothalamus, pituitary, lung and aorta (PubMed:1837590). 1
Induction：Atria (at protein level). 1 Publication
Developmental stage：Atria (at protein level). 1
Protein families：