TRY1_RAT P00762
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P00762
Recommended name：Serine protease 1 Imported
EC number：EC:3.4.21.4
Alternative names：Anionic trypsin I Imported Anionic trypsin-1 Imported Beta-trypsin Cationic trypsinogen Pretrypsinogen I Imported More alternative names
Cleaved into：
GeneID：24691
Gene names (primary )：Prss1
Gene names (synonym )：Trp1, Try1 By Similarity, Tryp1
Gene names (ORF )：
Length：246
Mass：25,959
Sequence：MSALLILALVGAAVAFPLEDDDKIVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Tissue specificity：
Induction：
Developmental stage：
Protein families：