HCD2_RAT O70351
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70351
Recommended name：3-hydroxyacyl-CoA dehydrogenase type-2
EC number：EC:1.1.1.35
Alternative names：17-beta-estradiol 17-dehydrogenase (EC:1.1.1.62 By Similarity) . EC:1.1.1.62 (UniProtKB | ENZYME | Rhea) By Similarity 2-methyl-3-hydroxybutyryl-CoA dehydrogenase (MHBD) 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)) (EC:1.1.1.239 By Similarity) . EC:1.1.1.239 (UniProtKB | ENZYME | Rhea) By Similarity 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC:1.1.1.178 By Similarity) . EC:1.1.1.178 (UniProtKB | ENZYME | Rhea) By Similarity 3-hydroxyacyl-CoA dehydrogenase type II More alternative names
Cleaved into：
GeneID：63864
Gene names (primary )：Hsd17b10
Gene names (synonym )：Erab, Hadh2
Gene names (ORF )：
Length：261
Mass：27,246
Sequence：MAAAVRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP
Tissue specificity：
Induction：
Developmental stage：
Protein families：