CHSTA_RAT   O54702


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O54702

Recommended name:Carbohydrate sulfotransferase 10

EC number:EC:2.8.2.-

Alternative names:HNK-1 sulfotransferase 1 Publication (HNK-1ST; HNK1ST; RaHNK-1ST; Sul-T)

Cleaved into:

GeneID:140568

Gene names  (primary ):Chst10

Gene names  (synonym ):

Gene names  (ORF ):

Length:356

Mass:42,027

Sequence:MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDGYSAKQEFVFLTAMPEAEKLRGEKHFSEVMKPTGKMLSESHPDQPPVYLERLELIRNACKEEALRNLSHTEVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSKIGIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRKNRTETRGIQFEDFVRYLGDPNRRWLDLQFGDHIIHWVTYVKLCAPCEIKYSVIGHHETLEADAPYILKEAGIDHLVSYPTIPPGITMYNRTKVEQYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLN

Tissue specificity:In myogenic progenitors, it is ubiquitously expressed. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp