ARGI2_RAT O08701
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08701
Recommended name:Arginase-2, mitochondrial
EC number:EC:3.5.3.1
Alternative names:Arginase II Kidney-type arginase Non-hepatic arginase Type II arginase
Cleaved into:
GeneID:29215
Gene names (primary ):Arg2
Gene names (synonym ):
Gene names (ORF ):
Length:354
Mass:38,640
Sequence:MFLRSSVSRLLHGQIPCALTRSVHSVAVVGAPFSRGQKKKGVEYGPAAIREAGLLKRLSMLGCHIKDFGDLSFTNVPKDDPYNNLVVYPRSVGIANQELAEVVSRAVSGGYSCVTLGGDHSLAIGTISGHARHHPDLCVIWVDAHADINTPLTTVSGNIHGQPLSFLIRELQDKVPQLPGFSWIKPCLSPPNLVYIGLRDVEPAEHFILKSFDIQYFSMRDIDRLGIQKVMEQTFDRLIGKRKRPIHLSFDIDAFDPKLAPATGTPVVGGLTYREGLYITEEIHSTGLLSALDLVEVNPHLATSEEEAKATASLAVDVIASSFGQTREGGHIAYDHLPTPSSPHESEKEECVRI
Tissue specificity:
Induction:
Developmental stage:
Protein families: