SPXN_RAT M0R8L2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:M0R8L2
Recommended name：Spexin
EC number：
Alternative names：Spexin-1 Spexin-2 Alternative names: NPQ 53-70
Cleaved into：
GeneID：
Gene names (primary )：SPX
Gene names (synonym )：
Gene names (ORF )：
Length：116
Mass：13,083
Sequence：MKGPSILAVAALALLLVLSVLENSSGAPQRLSEKRNWTPQAMLYLKGAQGHRFISDQSRRKELADRPPPERRNPNLQLLTLPEAAALFLASLEKPQKDEGGDFDKSKLLEDRRFYW
Tissue specificity：Widely expressed; predominantly expressed in epithelial cells in the skin, respiratory, digestive, urinary and reproductive systems, retina, adrenal gland and various brain regions. In the adrenal gland, expressed in parenchymal cells of the cortex and in ganglionic cells and intermingled cortical cells of the medulla. Expressed in the type I glomic cells within the carotid body (at protein level). Widely expressed. Strongly expressed in esophagus, liver, pancreas, kidney, brain, hypothalamus, thyroid and ovary. Expressed in the zona glomerulosa (ZG) and zona fasciculata/reticularis (ZF/R) of the adrenal gland. Also expressed in stomach, lung, skeletal muscle, heart, uterus, spleen, adrenal gland and testis. Weakly expressed in small intestine, thymus, urinary bladder and adenohypophysis. In the brain, is expressed in the Barrington's nucleus, with lesser amount in the ventrolateral caudal periaqueductal gray (PAG) and in the mesopontine tegmentum. 4 s
Induction：
Developmental stage：Up-regulated by enucleation-induced adrenocortical regeneration (at protein level). Up-regulated by dexamethasone (DX) treatment. Down-regulated by adrenocorticotropic hormone (ACTH) treatment. Up-regulated by hypoxia in the carotid body. 3 s
Protein families：