ABCG4_RAT   D3ZCM3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D3ZCM3

Recommended name:ATP-binding cassette subfamily G member 4

EC number:EC:7.6.2.-

Alternative names:ATP-binding cassette, sub-family G (WHITE), member 4 1 Publication

Cleaved into:

GeneID:300664

Gene names  (primary ):Abcg4

Gene names  (synonym ):

Gene names  (ORF ):

Length:650

Mass:72,491

Sequence:MAEKALEAVGCGLGPGAVAMAVALEDGAEPPVLTTHLKKVENHITEAQRFSHLPKRSAVDIEFVELSYSVREGPCWRKRGYKTLLKCLSGKFCRRELIGIMGPSGAGKSTFMNILAGYRESGMKGQILVNGRPRDLRTFRKMSCYIMQDDMLLPHLTVLEAMMVSANLKLSEKQEVKKELVTEILTALGLMSCSHTRTALLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKSLAHGGRTVICTIHQPSAKLFEMFDKLYILSQGQCIFKGVVTNLIPYLKGLGLHCPTYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCTMAEKKSSPEKNEVPAHCPTCPPELDPIESHTFATSTLTQFCILFRRTFLSILRDTVLTHLRFMSHVLIGVLIGLLYLHIGDDASKVFNNTGFLFFSMLFLMFAALMPTVLTCELICLAKMAVFMREHLNYWYSLKAYYLAKTMADVPFQVVCPVVYCSIVYWMTGQPAETSRFLLFSALSIATALVAQSLGLLIGAASTSLQVATFVGPVTAIPVLLFSGFFVSFKTIPTYLQWSSYLSYVRYGFEGLILTIYGMERGHLTCLEDHCPFRDPQIILHELDVEEAKLYMDFLVLGIFFLALRLLAYLVLRYRVKSER

Tissue specificity:Expressed specifically in the brain and the eye (PubMed:12183068). Expressed in both neonatal and adult oligodendrocytes (PubMed:21972082). 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp