MARHB_RAT A6P320
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A6P320
Recommended name：E3 ubiquitin-protein ligase MARCHF11
EC number：EC:2.3.2.27
Alternative names：Membrane-associated RING finger protein 11 Membrane-associated RING-CH protein XI (MARCH-XI) RING-type E3 ubiquitin transferase MARCHF11 Curated
Cleaved into：
GeneID：499558
Gene names (primary )：Marchf11
Gene names (synonym )：March11
Gene names (ORF )：
Length：398
Mass：44,085
Sequence：MSDEGSKRGSRADSLEAEPPLPPPPPPPPPGESSLVPTSPRYRPPLPAPLERIVGSGEPPVELAPRRKGEPLPPLPPSRLPGDQEVSAAGDSCEGPRRLPEVKLPEAAAGKGSPAEPEAGACREGERRGTGDQPETRSVYSSRSSSSGGSGDQRSGHQHQHHQPICKICFQGAEQGELLNPCRCDGSVRYTHQLCLLKWISERGSWTCELCCYRYHVTAIKMKQPCQWQSISITLVEKVQMIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVHEGAAVYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLSALRNRNLVHPTQLTSPRFQCGYVLLHLFNRMRAHEDVSEDNGSGEVVMRVTSV
Tissue specificity：Predominantly expressed in testis. Present in early developing spermatids. Not present in spermatogonia, spermatocytes or somatic cells (i.e. peritubular, Leydig, and Sertoli cells). Present in early round spermatids at step 4, remains until step 11, then it decreases at steps 12-15, and diminishes after step 16 (at protein level). Also expressed at lower level in brain. 1
Induction：
Developmental stage：
Protein families：