CLIC4_RAT Q9Z0W7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0W7
Recommended name：Chloride intracellular channel protein 4
EC number：
Alternative names：
Cleaved into：
GeneID：83718
Gene names (primary )：Clic4
Gene names (synonym )：
Gene names (ORF )：
Length：253
Mass：28,633
Sequence：MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPAHLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPGEIDENSMEDIKSSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Tissue specificity：Detected in brain, in cell bodies and dendrites of Purkinje cells in cerebellar neurons (at protein level) (PubMed:18302930). Expressed neonatal and adult cardiomyocytes (at protein level) (PubMed:26777142). Marked expression was found in hippocampus and cerebellum, and in many other tissues (PubMed:18302930, PubMed:9295337). 3 s
Induction：
Developmental stage：
Protein families：