CLIC4_RAT   Q9Z0W7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z0W7

Recommended name:Chloride intracellular channel protein 4

EC number:

Alternative names:

Cleaved into:

GeneID:83718

Gene names  (primary ):Clic4

Gene names  (synonym ):

Gene names  (ORF ):

Length:253

Mass:28,633

Sequence:MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPAHLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPGEIDENSMEDIKSSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

Tissue specificity:Detected in brain, in cell bodies and dendrites of Purkinje cells in cerebellar neurons (at protein level) (PubMed:18302930). Expressed neonatal and adult cardiomyocytes (at protein level) (PubMed:26777142). Marked expression was found in hippocampus and cerebellum, and in many other tissues (PubMed:18302930, PubMed:9295337). 3 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp