INSL3_RAT Q9WUK0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WUK0
Recommended name：Insulin-like 3
EC number：
Alternative names：Insulin-like 3 B chain Insulin-like 3 A chain
Cleaved into：
GeneID：114215
Gene names (primary )：Insl3
Gene names (synonym )：Rlf
Gene names (ORF )：
Length：128
Mass：14,110
Sequence：MHALLLLLLLALGSALRSPQPPEARAKLCGHHLVRALVRVCGGPRWSPEATQPVDTRDRELLQWLEQRHLLHALVADADPALDPDPALDPQLPHQASQRQRRSVATNAVHRCCLTGCTQQDLLGLCPH
Tissue specificity：Expressed in Leydig cells of the testis, and weakly in the theca interna cells of antral follicles and the corpus luteum of the ovary. 1
Induction：
Developmental stage：Highly expressed in adult testis and low expression in the ovary. Highly up-regulated in testes of day 19 embryos, but not in later neonatal stages, nor any ovarian tissue from this period. 1
Protein families：