CCN3_RAT Q9QZQ5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZQ5
Recommended name：CCN family member 3 Curated
EC number：
Alternative names：
Cleaved into：
GeneID：81526
Gene names (primary )：Ccn3
Gene names (synonym )：Nov Imported
Gene names (ORF )：
Length：351
Mass：38,510
Sequence：MSVFLRKQCLCLGFLLLHLLNQVSATLRCPSRCPSQCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNETGICMVPEGDNCVFDGVIYRNGEKFEPNCQYHCTCRDGQIGCVPRCQLDVLLPGPDCPAPKKVAVPGECCEKWTCGSEEKGTLGGLALPAYRPEATVGVELSDSSINCIEQTTEWSACSKSCGMGLSTRVTNRNLQCEMVKQTRLCMVRPCEQEPGEATDMKGKKCLRTKKSLKSIHLQFKNCTSLYTYKPRFCGICSDGRCCTPFNTKTIQVEFQCLPGQIIKKPVMVIGTCTCHSNCPQNNEAFLQELELKTSRGEM
Tissue specificity：Widely expressed. Highly expressed in neurons of dorsal root ganglia and dorsal horn of the spinal cord (at protein level) (PubMed:22353423). Expressed in astrocytes (at protein level) (PubMed:15213231). In cartilage, dominantly expressed in the chondrocyte territorial matrix (PubMed:21871891). 4 s
Induction：
Developmental stage：During persistent inflammatory pain the expression levels are down-regulated. 1
Protein families：