PCS1N_RAT   Q9QXU9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QXU9

Recommended name:ProSAAS

EC number:

Alternative names:KEP Big SAAS (b-SAAS) Little SAAS (l-SAAS) Big PEN-LEN (b-PEN-LEN) Alternative names: SAAS CT(1-49) PEN More chains

Cleaved into:

GeneID:246333

Gene names  (primary ):Pcsk1n

Gene names  (synonym ):

Gene names  (ORF ):

Length:260

Mass:27,414

Sequence:MAGSPLLCGPRAGGVGLLVLLLLGLLRLPPTLSARPVKEPRSLSAASAPLAETSTPLRLRRAVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRAWGSPRASDPPLAPDDDPDAPAAQLARALLRARLDPAALAAQLVPAPAPAAALRPRPPVYDDGPTGPDVEDAADETPDVDPELLRYLLGRILTGSSEPEAAPAPRRLRRAVDQDLGPEVPPENVLGALLRVKRLENSSPQAPARRLLPP

Tissue specificity:Expressed in adult brain (all major structural regions), adrenal gland (medulla) and spinal cord (dorsal and ventral horn). Expressed in pancreatic islands. 2 s

Induction:

Developmental stage:Expressed by 12.5 dpc in essentially all differentiating neurons in the mantle layer of the myelencephalon, metencephalon, diencephalon, spinal cord and several sympathetic ganglia. During later stages of prenatal development, widespread expression continues in post-mitotic neurons of both the CNS and PNS and begins in endocrine cells of the anterior and intermediate pituitary. 1

Protein families:


   💬 WhatsApp