A4GAT_RAT Q9JI93
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JI93
Recommended name：Lactosylceramide 4-alpha-galactosyltransferase
EC number：EC:2.4.1.228
Alternative names：Alpha-1,4-N-acetylglucosaminyltransferase Alpha-1,4-galactosyltransferase Alpha4Gal-T1 Globotriaosylceramide synthase (Gb3 synthase) UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
Cleaved into：
GeneID：63888
Gene names (primary )：A4galt
Gene names (synonym )：
Gene names (ORF )：
Length：360
Mass：41,551
Sequence：MGISRSDLEETMSKPPDCLPRMLRGTPRQRVFTLFIISFKFTFLVSILIYWHTVGAPKDQRRQYSLPVDFPCPQLAFPRVSAPGNIFFLETSDRTNPSFLFMCSVESAARAHPESQVVVLMKGLPRDTTAWPRNLGISLLSCFPNVQIRPLDLQELFEDTPLAAWYLEAQHRWEPYLLPVLSDASRIALLWKFGGIYLDTDFIVLKNLRNLTNMLGIQSRYVLNGAFLAFERKHEFLALCIRDFVAHYNGWIWGHQGPQLLTRVFKKWCSIHSLKESRACRGVTALPPEAFYPIPWQNWKKYFEDVSPEELAQLLNATYAVHVWNKKSQGTHLEATSRALLAQLHARYCPTTHRAMTMYL
Tissue specificity：Ubiquitous. Highly expressed in kidney, mesenteric lymph node, spleen and brain. 1
Induction：
Developmental stage：
Protein families：glycosyltransferase 32 family