UBE2N_RAT   Q9EQX9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EQX9

Recommended name:Ubiquitin-conjugating enzyme E2 N

EC number:EC:2.3.2.23

Alternative names:Bendless-like ubiquitin-conjugating enzyme E2 ubiquitin-conjugating enzyme N Ubiquitin carrier protein N Ubiquitin-protein ligase N

Cleaved into:

GeneID:116725

Gene names  (primary ):Ube2n

Gene names  (synonym ):

Gene names  (ORF ):

Length:152

Mass:17,124

Sequence:MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKSNEAQAIETARAWTRLYAMNNI

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp