CBPB2_RAT   Q9EQV9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EQV9

Recommended name:Carboxypeptidase B2

EC number:EC:3.4.17.20

Alternative names:Carboxypeptidase R (CPR) Carboxypeptidase U (CPU) Thrombin-activable fibrinolysis inhibitor (TAFI)

Cleaved into:

GeneID:113936

Gene names  (primary ):Cpb2

Gene names  (synonym ):

Gene names  (ORF ):

Length:422

Mass:48,827

Sequence:MKLYGLGVLVAIILYEKHGLAFQSGHVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVNSVKAYLNASRIPFNVLMNNVEDLIQQQTSNDTVSPRASSSYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSYEKYPLYVLKVSGKEHRVKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENTYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSVHMNNRCVGTDLNRNFASKHWCEKGASSFSCSETYCGLYPESEPEVKAVADFLRRNINHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERFIKPTCAEALAAVSKIAWHVIRNS

Tissue specificity:Plasma; synthesized in the liver.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp