ASGL1_RAT Q8VI04
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VI04
Recommended name：Isoaspartyl peptidase/L-asparaginase
EC number：EC:3.4.19.5
Alternative names：Asparaginase-like protein 1 Asparaginase-like sperm autoantigen Beta-aspartyl-peptidase Glial asparaginase Isoaspartyl dipeptidase L-asparagine amidohydrolase
Cleaved into：
GeneID：246307
Gene names (primary )：Asrgl1
Gene names (synonym )：Alp, Gliap, Hiob
Gene names (ORF )：
Length：333
Mass：34,410
Sequence：MATARPSSCGRDSVPATPRASIDVSLVVVVHGGGASNISPGRKELVSEGIAKAATEGYNILKAGGSAVDAVEGAVTMLENDPEFNAGYGSVLNADGDIEMDASIMDGKDLSAGAVSAVRCIANPVKLARLVMEKTPHCFLTGRGAEKFAADMGIPQTPAEKLITERTKKHLEKEKLEKGAQKADCPKNSGTVGAVALDCKGNLAYATSTGGIVNKMVGRVGDSPCIGAGGYADNNLGAVSTTGHGESILKVNLARLALFHVEQGKTVDEAATLALDYMKSKLKGLGGLILINKTGDWVAKWTSASMPWAAVKNGKLQAGIDLCETKTRNLPTC
Tissue specificity：Present in testis, brain, liver, kidney, heart and skeletal muscle. In brain, specifically present in the astrocytic lineage. Present in sperm (at protein level). 2 s
Induction：
Developmental stage：
Protein families：