SIAH2_RAT   Q8R4T2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R4T2

Recommended name:E3 ubiquitin-protein ligase SIAH2

EC number:EC:2.3.2.27

Alternative names:RING-type E3 ubiquitin transferase SIAH2 Curated Seven in absentia homolog 2 (Siah-2)

Cleaved into:

GeneID:140593

Gene names  (primary ):Siah2

Gene names  (synonym ):

Gene names  (ORF ):

Length:325

Mass:34,700

Sequence:MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ

Tissue specificity:Detected in brain (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp