BST2_RAT   Q811A2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q811A2

Recommended name:Bone marrow stromal antigen 2

EC number:

Alternative names:Protein DAMP-1

Cleaved into:

GeneID:378947

Gene names  (primary ):Bst2

Gene names  (synonym ):Damp1

Gene names  (ORF ):

Length:172

Mass:19,674

Sequence:MAPSFYHYLPVAMDERWEPKGWSIRRWWLVAAILVVLIGVVLVCLIVYFANAAHSEACKNGLRLQDECRNTTHLLKHQLTRAQDSLLQTEMQANSCNQTVMDLRDSLKKKVSQTQEQQARIKELENKIERLNQELENLRTQKEISTTVQVNSGGSVVVSSLLVLVAVLFLHF

Tissue specificity:Ubiquitously expressed, with highest levels in brain and liver. Present in liver (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp