R4RL1_RAT Q80WD0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80WD0
Recommended name：Reticulon-4 receptor-like 1
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Rtn4rl1
Gene names (synonym )：Ngrh2 1 Publication Imported
Gene names (ORF )：
Length：445
Mass：49,775
Sequence：MLRKGCCVELLLLLLAGELPLSGGCPRDCVCYPSPMTVSCQAHNFAAIPEGIPEDSERIFLQNNHITFLQQGHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSSLPAGIFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLLHENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSVVPCATPELRQGQDLKSLRVEDFRNCTGPASPHQIKSHTLSTSDRAARKEHHPSHGASRDKGHPHGHLPGSRSGSKKPGKNCTSHRNRNQISKGSAGKELPELQDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQASSGTALGVSLLAWILGLVVSLR
Tissue specificity：Detected in brain (at protein level) (PubMed:15673660). Expressed in various regions of the brain, including the cerebral cortex, hippocampus, striatum, thalamus and cerebellum (PubMed:12694398). 2 s
Induction：
Developmental stage：
Protein families：