SO4C1_RAT Q71MB6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q71MB6
Recommended name：Solute carrier organic anion transporter family member 4C1
EC number：
Alternative names：Organic anion transporting polypeptide 4C1 2 Publications (OATP4C1 2 Publications) Solute carrier family 21 member 20
Cleaved into：
GeneID：432363
Gene names (primary )：Slco4c1
Gene names (synonym )：Oatp4c1 1 Publication, Slc21a20 By Similarity
Gene names (ORF )：
Length：724
Mass：78,648
Sequence：MQGSKGVENPAFVPSSPDTPRRASASPSQVEVSAVASRNQNGGSQPRESEDPQKSTEPSPPSSTLPASDEPPGSQLSELEEGPCGWRNFHPQCLQRCNNPKGFLLHYCLLALTQGIVVNGLVNISISTIEKRYEMKSSLTGLISSSYDISFCVLSLFVSFFGERGHKPRWLAFASFMIGLGALVFSLPHFFSGRYELGTIFEDTCLTRNSTRCASSTSLLSNYFYVFVLGQLLLGTGGTPLYTLGTAFIDDSVPTHKSSLYIGIGYSMSILGPAIGYVLGGQLLTMYIDVAMGQSSDLTEDDPRWLGAWWIGFLLAWLFAWSLIMPFSCFPKHLPGTAKIQAGKTSQTHQNNSTSFQHMDENFGKSIKDFPTAVKNLMRNTVFICLVLSTTSEALVTTGFATFLPKFIENQFGLTSSFAATLGGAVLIPGAALGQILGGVLVSKFKMKCKNTMKFALCTSGVALMLSFVFIYAKCENGPFAGVSESYNGTGEMGNLTAPCNANCNCLRSYYYPLCGSDGVQYFSPCFAGCLNSVSNRKPKAYYNCSCIERKVDITSTAXSPDFEARAGKCKTQCSNLPIFLGIFFITVIFTFMAGTPITVSILRCVNHRQRSLALGVQFMLLRLLGTIPGPIIFGVTIDSTCVLWDINECGTKGACWIYDNIRMAHMLVAISVTCKVITIFFNGLAIVLYKPPPPGTEVSFQSQNVVVSTITVEEDLNKIENEG
Tissue specificity：Predominantly expressed in kidney and lung but also weakly expressed in brain (PubMed:14993604). Localizes primarily in the proximal straight tubules, the S3 fraction of the nephron (PubMed:22768102). 2 s
Induction：
Developmental stage：Expression is significantly decreased in renal failure. 1
Protein families：