PAG15_RAT Q675A5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q675A5
Recommended name：Lysosomal phospholipase A and acyltransferase
EC number：EC:2.3.1.-
Alternative names：1-O-acylceramide synthase 1 Publication (ACS 1 Publication) LCAT-like lysophospholipase By Similarity (LLPL By Similarity) (EC:3.1.1.5 By Similarity) . EC:3.1.1.5 (UniProtKB | ENZYME | Rhea) By Similarity Lysophospholipase 3 Lysosomal phospholipase A2 1 Publication (LPLA2 1 Publication) Phospholipase A2 group XV By Similarity
Cleaved into：
GeneID：361401
Gene names (primary )：Pla2g15
Gene names (synonym )：Lypla3
Gene names (ORF )：
Length：413
Mass：47,391
Sequence：MDRHLCICREIQLRSGLLFPFLLLMMLADLALPAQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGETFSLEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALQEMIEEMYQMYGGPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQDIGFEDGWFMRQDTQGLVEALVPPGVELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP
Tissue specificity：Detected in alveolar macrophages (at protein level). Widely expressed. Expressed at highest levels in alveolar macrophages. 1
Induction：
Developmental stage：
Protein families：