PPP6_RAT Q64620
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64620
Recommended name:Serine/threonine-protein phosphatase 6 catalytic subunit Curated
EC number:EC:3.1.3.16
Alternative names:PP6C By Similarity
Cleaved into:
GeneID:171121
Gene names (primary ):Ppp6c
Gene names (synonym ):Ppv 1 Publication
Gene names (ORF ):
Length:305
Mass:35,159
Sequence:MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL
Tissue specificity:Highest levels found in spleen, brain and lung. 1
Induction:
Developmental stage:
Protein families: